PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G308400.1.p
Common NameSb02g033830, SORBIDRAFT_02g033830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 385aa    MW: 40713 Da    PI: 6.8242
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G308400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181360148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEde+lv++++ +G  +W++++++ g+ R++k+c++rw +yl
  Sobic.002G308400.1.p 13 RGLWSPEEDEKLVKYITAHGHSCWSAVPKHAGLQRCGKSCRLRWINYL 60
                          788*******************************************97 PP

2Myb_DNA-binding48.61.9e-1566109146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg ++  E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Sobic.002G308400.1.p  66 RGTFSDHEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                           899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26463IPR009057Homeodomain-like
PROSITE profilePS5129417.851860IPR017930Myb domain
SuperFamilySSF466891.16E-2710107IPR009057Homeodomain-like
SMARTSM007171.4E-131262IPR001005SANT/Myb domain
PfamPF002499.5E-161360IPR001005SANT/Myb domain
CDDcd001678.58E-121660No hitNo description
PROSITE profilePS5129424.33361115IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2464116IPR009057Homeodomain-like
SMARTSM007178.2E-1565113IPR001005SANT/Myb domain
PfamPF002492.0E-1366109IPR001005SANT/Myb domain
CDDcd001676.02E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVKYITA HGHSCWSAVP KHAGLQRCGK SCRLRWINYL  60
RPDLKRGTFS DHEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPKTHNLLPA SRTLLQGGNG ANPSGNNPAQ FHSNGGGAAV GSVATTPFTI SSPTKAAAYD  180
TVTVTPPPEM APAMYDVPNH DGMLMGHDQA AAAPIPAYPY LDNGGGVLMS FRDQNAGLQT  240
SMDFMNGSSS SSSMDHAAGM PNGNGFSQGM GAAAFMDVTA GMWNTAAVDS AMCAGMEVVQ  300
PQQQPLPPPQ GLLQGEMVVG RQAVMNGGGA VADKGMDMMD VSSVYGGAGT TTFDLELMES  360
CALFCGSGVG GATGNAMEQL QWDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460723.10.0hypothetical protein SORBIDRAFT_02g033830
TrEMBLC5X9860.0C5X986_SORBI; Putative uncharacterized protein Sb02g033830
STRINGSb02g033830.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.16e-82myb domain protein 67